DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and Btf3

DIOPT Version :10

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_663430.2 Gene:Btf3 / 218490 MGIID:1202875 Length:204 Species:Mus musculus


Alignment Length:171 Identity:44/171 - (25%)
Similarity:82/171 - (47%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFKTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSS 65
            |:.:.|.|::..|||||.|:.|||.|.:......|:|:::.:|..|.:.|:..|:|:.:..:..:
Mouse    48 MNQEKLAKLQAQVRIGGKGTARRKKKVVHRTATADDKKLQFSLKKLGVNNISGIEEVNMFTNQGT 112

  Fly    66 EVVVIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHKPKSFSDKKAESGESIKMVAKK 130
            .:....|::|.:..:..|.::||...|.||           ...|...:...|:|..|::.:|  
Mouse   113 VIHFNNPKVQASLAANTFTITGHAETKQLT-----------EMLPSILNQLGADSLTSLRRLA-- 164

  Fly   131 PKNKEEAAMAGGDSEPKLS-NGKSILISSEDGSDPDNEKVP 170
                        ::.||.| :||:.|.:.||    |:::||
Mouse   165 ------------EALPKQSVDGKAPLATGED----DDDEVP 189

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 6..>95 CDD:454759 25/88 (28%)
Btf3NP_663430.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..43
NAC_BTF3 51..167 CDD:409234 32/140 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 168..190 11/26 (42%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.