DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment betaNACtes2 and icd-1

DIOPT Version :9

Sequence 1:NP_727777.1 Gene:betaNACtes2 / 32386 FlyBaseID:FBgn0030563 Length:197 Species:Drosophila melanogaster
Sequence 2:NP_495336.1 Gene:icd-1 / 174090 WormBaseID:WBGene00002045 Length:161 Species:Caenorhabditis elegans


Alignment Length:174 Identity:46/174 - (26%)
Similarity:72/174 - (41%) Gaps:35/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KTLKKMEEAVRIGGNGSMRRKHKKIPSLNADDEKRVRAALAMLPLKNLGEIQEMTIKFSDSSEVV 68
            |.|:..:|.|||||.|:.|||.|.|....|.|:|::::.|..|.:.|:..|:|:.:...|.:.:.
 Worm    11 KKLQAQQEHVRIGGKGTPRRKKKVIHKTAAADDKKLQSNLKKLSVTNIPGIEEVNMIKDDGTVIH 75

  Fly    69 VIMPRIQKTNPSYFFVMSGHFVRKSLTAGPSKAPKAPKPHKPKSFSDKKAESGESIKMVAKKPKN 133
            ...|::|.:.|:..|.::|....|.:|   ...|.......|:|.:..|                
 Worm    76 FNNPKVQTSVPANTFSVTGSADNKQIT---EMLPGILNQLGPESLTHLK---------------- 121

  Fly   134 KEEAAMAGGDSEPKLSNGKSILISSEDGSDPDNEKVPSDESDVD 177
                         ||:|..:.|  ..||...| |.||....|.|
 Worm   122 -------------KLANNVTKL--GPDGKGED-EDVPELVGDFD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
betaNACtes2NP_727777.1 NAC 38..91 CDD:280093 11/52 (21%)
icd-1NP_495336.1 NAC 45..96 CDD:280093 11/50 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2240
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435264at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10351
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.