DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Pi15

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:281 Identity:70/281 - (24%)
Similarity:100/281 - (35%) Gaps:86/281 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLFVLACEKGLAGAQTLIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPAC 82
            |:|..|.||   |....|:....::.||::.....|||........:                  
Mouse    21 VILLSLLCE---AHTVVLLNPTDSSLPANNFTDTEAALSTPLESADI------------------ 64

  Fly    83 GPEPKLLEMSERRRQL-------LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALH 140
               ||    :.|:|.:       :||.||..|.|:       :..||:|..:.||..|.:.|...
Mouse    65 ---PK----ARRKRYISQNDMIAILDYHNQVRGKV-------FPPAANMEYMVWDENLAKSAEAW 115

  Fly   141 AKRCQFAHDKCRNTPRF--KFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYH 203
            |..|.:.|.     |.:  :|.|||:. ...||     .|.:...|..|:.|.:|  .:|     
Mouse   116 AATCIWDHG-----PSYLLRFLGQNLS-VRTGR-----YRSILQLVKPWYDEVKD--YAF----- 162

  Fly   204 PHPQ-----------GKKIGHFTLLVSDRVNRVGCAGVRFLEPKSN--------RFQFMLTCNY- 248
            |:||           |....|:|.:|....||:|||    :....|        |....|.||| 
Mouse   163 PYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCA----IHTCQNMNVWGSVWRRAVYLVCNYA 223

  Fly   249 DYNNIFNEPIYQSGPAGSKCP 269
            ...|...|..|:.|...|.||
Mouse   224 PKGNWIGEAPYKVGVPCSSCP 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 48/181 (27%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 46/171 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841283
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.