DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and PRY3

DIOPT Version :10

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:19/78 - (24%)
Similarity:32/78 - (41%) Gaps:18/78 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 WFREHQDANQSFIDRYHPHPQG--KKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNY- 248
            |:.|        |.:|:....|  :..||||.:|......:|| |.::.....|.:   :.|:| 
Yeast    93 WYGE--------ISKYNYSNPGFSESTGHFTQVVWKSTAEIGC-GYKYCGTTWNNY---IVCSYN 145

  Fly   249 ---DYNNIFNEPI 258
               :|...|.|.:
Yeast   146 PPGNYLGEFAEEV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 CAP_euk 96..249 CDD:349399 16/67 (24%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 17/70 (24%)
ser_rich_anae_1 <449..>709 CDD:468206
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.