DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and PRY3

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:78 Identity:19/78 - (24%)
Similarity:32/78 - (41%) Gaps:18/78 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 WFREHQDANQSFIDRYHPHPQG--KKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNY- 248
            |:.|        |.:|:....|  :..||||.:|......:|| |.::.....|.:   :.|:| 
Yeast    93 WYGE--------ISKYNYSNPGFSESTGHFTQVVWKSTAEIGC-GYKYCGTTWNNY---IVCSYN 145

  Fly   249 ---DYNNIFNEPI 258
               :|...|.|.:
Yeast   146 PPGNYLGEFAEEV 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 16/67 (24%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 17/70 (24%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.