DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and AT1G01310

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_171638.2 Gene:AT1G01310 / 839333 AraportID:AT1G01310 Length:241 Species:Arabidopsis thaliana


Alignment Length:224 Identity:52/224 - (23%)
Similarity:79/224 - (35%) Gaps:73/224 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 THLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPL 126
            |.|:..|.:..||..||........:...::...|:.|: .|||.|:::..            |.
plant    52 TRLLLSPPSFTGNRFSFRFRWRRIRRRNRVNRASREFLI-AHNLVRARVGE------------PP 103

  Fly   127 LRWDTELEQMAALHAKR----CQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINW 187
            .:||..|...|...|.:    |:..|.   |.|    .|:||  ||.|:    ::...:..|..|
plant   104 FQWDGRLAAYARTWANQRVGDCRLVHS---NGP----YGENI--FWAGK----NNWSPRDIVNVW 155

  Fly   188 FREHQDANQSFIDRYHP------HPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTC 246
            ..|         |:::.      .|| ...||:|.:|.....:||||.|                
plant   156 ADE---------DKFYDVKGNTCEPQ-HMCGHYTQIVWRDSTKVGCASV---------------- 194

  Fly   247 NYDYNN-------IFNEPIYQSG--PAGS 266
              |.:|       ::|.|....|  |.||
plant   195 --DCSNGGVYAICVYNPPGNYEGENPFGS 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 37/162 (23%)
AT1G01310NP_171638.2 SCP_PR-1_like 87..219 CDD:240181 41/185 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.