DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:234 Identity:62/234 - (26%)
Similarity:92/234 - (39%) Gaps:65/234 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CGNNGSFSPACGPEPKLLEM-------SERRRQL-------LLDMHNLARSKIASGNLDGYRSAA 122
            ||:.|...|......:||..       |..||.:       :|.:||..|.::..       .|:
Human    18 CGSQGYLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQVQP-------QAS 75

  Fly   123 HMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINW 187
            :|..:.||.|||:.||..|.:|.:.|..   |......|||:|..| || ::|....::|    |
Human    76 NMEYMTWDDELEKSAAAWASQCIWEHGP---TSLLVSIGQNLGAHW-GR-YRSPGFHVQS----W 131

  Fly   188 FREHQDANQSFIDRYHPHP-----------QGKKIGHFTLLVSDRVNRVGCA----------GVR 231
            :.|.:|..       :|:|           .|....|:|.:|....|::|||          |  
Human   132 YDEVKDYT-------YPYPSECNPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWG-- 187

  Fly   232 FLEPKSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCP 269
              |...|...|:  |||. ..|...|..|::|...|:||
Human   188 --EVWENAVYFV--CNYSPKGNWIGEAPYKNGRPCSECP 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 46/180 (26%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 45/173 (26%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151227
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.