DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Crispld1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001343480.1 Gene:Crispld1 / 83691 MGIID:1934666 Length:500 Species:Mus musculus


Alignment Length:194 Identity:56/194 - (28%)
Similarity:85/194 - (43%) Gaps:37/194 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTP 155
            :::...|.:||:||..||::       |.:|::|..:.||.|||:.|...|:.|.:.|......|
Mouse    57 ITDNDMQSILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAEMCLWEHGPASLLP 114

  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKSFVIN-WFREHQDANQSF---IDRYHP-HPQGKKIGHFT 215
            ..   |||:|..| ||      .|..:|.:. |:.|.:|.:..:   .|.|.| ...|....|:|
Mouse   115 SI---GQNLGAHW-GR------YRPPTFHVQAWYDEVRDFSYPYENECDPYCPFRCSGPVCTHYT 169

  Fly   216 LLVSDRVNRVGCAGVRF---------LEPKSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCP 269
            .:|....:|:||| |..         :.||:    ..|.|||. ..|.:....|:.|...|.||
Mouse   170 QVVWATSSRIGCA-VNLCHNMNIWGQIWPKA----VYLVCNYSPKGNWWGHAPYKHGRPCSACP 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 49/166 (30%)
Crispld1NP_001343480.1 CAP_CRISPLD1 62..207 CDD:349407 49/166 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..281
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841241
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.