DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:195 Identity:57/195 - (29%)
Similarity:87/195 - (44%) Gaps:39/195 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTP 155
            :::...|.:||:||..||::       |.:|::|..:.||.|||:.|...|:.|.:.|......|
Human    57 ITDNDMQSILDLHNKLRSQV-------YPTASNMEYMTWDVELERSAESWAESCLWEHGPASLLP 114

  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKSF-VINWFREHQDANQSFIDRYHPH-P---QGKKIGHFT 215
            ..   |||:|..| ||      .|..:| |.:|:.|.:|.:..:....:|: |   .|....|:|
Human   115 SI---GQNLGAHW-GR------YRPPTFHVQSWYDEVKDFSYPYEHECNPYCPFRCSGPVCTHYT 169

  Fly   216 LLVSDRVNRVGCA----------GVRFLEPKSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCP 269
            .:|....||:|||          |.  :.||:    ..|.|||. ..|.:....|:.|...|.||
Human   170 QVVWATSNRIGCAINLCHNMNIWGQ--IWPKA----VYLVCNYSPKGNWWGHAPYKHGRPCSACP 228

  Fly   270  269
            Human   229  228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 50/167 (30%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 50/166 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151164
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.