DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and AT5G57625

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_680450.1 Gene:AT5G57625 / 835867 AraportID:AT5G57625 Length:207 Species:Arabidopsis thaliana


Alignment Length:158 Identity:42/158 - (26%)
Similarity:60/158 - (37%) Gaps:39/158 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKR----CQFAHDKCRNTPRF 157
            :|.||.||..||.:.            :|.|.||.:|...|...|.:    |...|    :|..:
plant    73 RLFLDPHNALRSGLG------------LPPLIWDGKLASYATWWANQRRYDCSLTH----STGPY 121

  Fly   158 KFSGQNIGYFWIGREFKSHSRRMKSFVI-NWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDR 221
               |:|:  ||     .|.|.....|.: :|..|    .:|:....:........||:|.:|...
plant   122 ---GENL--FW-----GSGSSWAPGFAVQSWIVE----GRSYNHNTNSCDGSGMCGHYTQMVWRD 172

  Fly   222 VNRVGCAGVRFLEPKSNRFQFMLTCNYD 249
            ..|:|||.|    ...|.....:|||||
plant   173 TKRLGCARV----VCENGAGVFITCNYD 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 40/156 (26%)
AT5G57625NP_680450.1 CAP_PR-1 72..207 CDD:349400 42/158 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.