DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and AT4G33730

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_195099.1 Gene:AT4G33730 / 829515 AraportID:AT4G33730 Length:172 Species:Arabidopsis thaliana


Alignment Length:191 Identity:44/191 - (23%)
Similarity:66/191 - (34%) Gaps:59/191 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LLLDMHNLARSKIASGNLDGY-----------------RSAAHMPLLRWDTELEQMAALHAKR-- 143
            |||.::.|.:..::|.....|                 |:|..:..||||..:..:|..:|..  
plant    12 LLLLINYLTQIDVSSAQYSQYPQSHEYPDSYLRPHNAARAAVKVKPLRWDFGIATVAQDYANHLA 76

  Fly   144 ---CQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPH 205
               |...|.   :.|    .|:|:.       |.|........|..|..|     :|:.|.|...
plant    77 SGPCSLEHS---SGP----YGENLA-------FGSGDMSAAQAVAMWVHE-----KSYYDFYSNS 122

  Fly   206 PQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGS 266
            ..|...||:|.:|.....|:||.     :.|.|....::.||||             |||:
plant   123 CHGPACGHYTQVVWRGSARLGCG-----KAKCNNGASIVVCNYD-------------PAGN 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 39/172 (23%)
AT4G33730NP_195099.1 CAP_PR-1 39..172 CDD:349400 38/164 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.