DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and AT4G33710

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_195097.1 Gene:AT4G33710 / 829513 AraportID:AT4G33710 Length:166 Species:Arabidopsis thaliana


Alignment Length:163 Identity:42/163 - (25%)
Similarity:68/163 - (41%) Gaps:37/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 SERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKR----CQFAHDKCR 152
            ::.|||..||:||.||..::            :|.::|.....:.|..:|:|    |:..|...|
plant    27 AQDRRQDYLDVHNHARDDVS------------VPHIKWHAGAARYAWNYAQRRKRDCRLIHSNSR 79

  Fly   153 NTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLL 217
            .  |:   |:|:.  |...:...     .:.|..|.||..|    :..:.:....||:.||:|.:
plant    80 G--RY---GENLA--WSSGDMSG-----AAAVRLWVREKSD----YFHKSNTCRAGKQCGHYTQV 128

  Fly   218 VSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDY 250
            |......||||.|     |.:.....:||||.:
plant   129 VWKNSEWVGCAKV-----KCDNGGTFVTCNYSH 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 40/156 (26%)
AT4G33710NP_195097.1 CAP_PR-1 32..166 CDD:349400 40/158 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.