DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and AT3G19690

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:167 Identity:46/167 - (27%)
Similarity:64/167 - (38%) Gaps:45/167 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKR----CQFAHDKC 151
            ::|..:|..|:.||.||:::   .||        ||: ||.|:...||.:|.:    |...|.  
plant    21 LAEDLQQQFLEAHNEARNEV---GLD--------PLV-WDDEVAAYAASYANQRINDCALVHS-- 71

  Fly   152 RNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQ----DANQSFIDRYHPHPQGKKIG 212
             |.|    .|:||.       ..|.....:.....|..|.|    |:|..      ..|.|....
plant    72 -NGP----FGENIA-------MSSGEMSAEDAAEMWINEKQYYDYDSNTC------NDPNGGTCL 118

  Fly   213 HFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYD 249
            |:|.:|.....|:|||.|     ..|.....:|||||
plant   119 HYTQVVWKNTVRLGCAKV-----VCNSGGTFITCNYD 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 43/160 (27%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 45/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.