DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and PR-1-LIKE

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_179589.1 Gene:PR-1-LIKE / 816518 AraportID:AT2G19990 Length:176 Species:Arabidopsis thaliana


Alignment Length:178 Identity:42/178 - (23%)
Similarity:72/178 - (40%) Gaps:58/178 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDK 150
            ||.....:.:.|..|.:||.||:.:..|           |:: |:..|    |.:|:  .:||::
plant    32 PKANANGDVKPQETLVVHNKARAMVGVG-----------PMV-WNETL----ATYAQ--SYAHER 78

  Fly   151 CRNTPRFKFS----GQNIGYFW------IGREFKSHSRRMKSFVINWFREHQ----DANQSFIDR 201
            .|:. ..|.|    |:|:...|      :..|:             |..|.:    |:|....|.
plant    79 ARDC-AMKHSLGPFGENLAAGWGTMSGPVATEY-------------WMTEKENYDYDSNTCGGDG 129

  Fly   202 YHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYD 249
            .        .||:|.:|.....|:|||.||.   |::.:.::: |:||
plant   130 V--------CGHYTQIVWRDSVRLGCASVRC---KNDEYIWVI-CSYD 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 38/166 (23%)
PR-1-LIKENP_179589.1 CAP_PR-1 42..176 CDD:349400 40/168 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.