DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and AT2G19980

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:130 Identity:31/130 - (23%)
Similarity:54/130 - (41%) Gaps:41/130 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 EQMAALHAKRCQFAHDKCRNTPRFKFS-----GQNIGYFW----------IGREFKSHSRRMKSF 183
            :|..|.||:|  :|:.:.::. ..|:|     |:||...|          |..:|          
plant    49 DQKLAAHAQR--YANVRSQDC-AMKYSTDGTYGENIAAGWVQPMDTMSGPIATKF---------- 100

  Fly   184 VINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNY 248
               ||.|....|      |..:...:..||:|.:|:::...:||..||..:   |.:.::: |||
plant   101 ---WFTEKPYYN------YATNKCSEPCGHYTQIVANQSTHLGCGTVRCFK---NEYVWVV-CNY 152

  Fly   249  248
            plant   153  152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 31/130 (24%)
AT2G19980NP_179588.1 SCP 35..165 CDD:294090 31/130 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.