DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Crisp4

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001333976.1 Gene:Crisp4 / 78081 MGIID:1925331 Length:293 Species:Mus musculus


Alignment Length:288 Identity:63/288 - (21%)
Similarity:101/288 - (35%) Gaps:74/288 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 PASSGGYCAAALCELYNGTHLVH--VPHTACGNN----------GSFSPACGPEP---------K 87
            |.|.|     |||...:..||..  .|...|...          .:|.|.....|         |
Mouse    16 PPSPG-----ALCLSISSGHLGSRTPPSVFCTGMAVKFILLLFVAAFVPVVTIRPLKLDRALYNK 75

  Fly    88 LLEMSERR-RQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC 151
            |:..|:.. ::.:::.||..|.|::.       .|.:|..:.|.:...:.|.:.|:.|    ||.
Mouse    76 LITESQTEPQEEIVNTHNAFRRKVSP-------PARNMLKVSWSSAAAENARILARYC----DKS 129

  Fly   152 ------RNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN-WFREHQDANQSFIDRYHPHPQGK 209
                  |..|. .|.|:|:        ...|.....|.||. ||      |:|...:|...|...
Mouse   130 DSDSLERRLPN-TFCGENM--------LMEHYPSSWSKVIEIWF------NESKYFKYGEWPSTD 179

  Fly   210 ---KIGHFTLLVSDRVNRVGC--AGVRFLEPKSNRFQFMLTCNY----DYNNIFNEPIYQSGPAG 265
               :..|:|.:|......|||  |..|    :.....::..|:|    ::.:..|.| |:.|...
Mouse   180 DDIETDHYTQMVWASTYLVGCDVAACR----RQKAATYLYVCHYCHEGNHQDTLNMP-YKEGSPC 239

  Fly   266 SKCPQHRISEKFPSLCDWRDANNDLDSE 293
            ..||.:.......:.|.:.|..|:.|::
Mouse   240 DDCPNNCEDGLCTNPCIYYDEYNNCDTQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 37/168 (22%)
Crisp4NP_001333976.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841346
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.