DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CRISP2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:255 Identity:50/255 - (19%)
Similarity:86/255 - (33%) Gaps:63/255 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 PACGPEPKLLEMSERRRQL---LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHA 141
            ||.|.:|....:...:.|:   :::.||..|..::.       .|::|..:.|..|:...|...|
Human    18 PAEGKDPAFTALLTTQLQVQREIVNKHNELRKAVSP-------PASNMLKMEWSREVTTNAQRWA 75

  Fly   142 KRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHP 206
            .:|...|....:.......|:|:       ...|......|.:.:|:.|..|    |:....|..
Human    76 NKCTLQHSDPEDRKTSTRCGENL-------YMSSDPTSWSSAIQSWYDEILD----FVYGVGPKS 129

  Fly   207 QGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNY----------------------- 248
            ....:||:|.||.....:||| |:.:. |..:..::...|.|                       
Human   130 PNAVVGHYTQLVWYSTYQVGC-GIAYC-PNQDSLKYYYVCQYCPAMKTYLNKREGINVWKCFLRL 192

  Fly   249 --------------DYNNI--FNEPIYQSGPAGSKCPQHRISEKFPSLCDWRDANNDLDS 292
                          ..||:  .|.| ||.|...:.||.........:.|.::|..::.||
Human   193 RHFQLLRGEQLLTFSGNNMNRKNTP-YQQGTPCAGCPDDCDKGLCTNSCQYQDLLSNCDS 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 33/192 (17%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 33/156 (21%)
Crisp 224..278 CDD:285731 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151290
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.