DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:204 Identity:53/204 - (25%)
Similarity:82/204 - (40%) Gaps:39/204 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHD 149
            :||.::       ..|::||..|.|:..       .||.|..|.||.:|.::|....:.|:.||:
Mouse    38 DPKFID-------AFLNIHNELRRKVQP-------PAADMNQLFWDQQLAKLAKAWTRECKLAHN 88

  Fly   150 KC-----RNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGK 209
            .|     .....:.|.|:||   ::||    ...:.:..||||:.|.:..|..|      :...:
Mouse    89 PCIKQRYECLEDYDFIGENI---YLGR----IETQPEDVVINWYNESKYFNFDF------NTCSE 140

  Fly   210 KIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQF-MLTCNYD-YNNIFNEPIYQSGPAGSKCPQHR 272
            ..||:|.:|..:..::|||....  |....|.. :..|||. ..|......|..|.:.|.|.|..
Mouse   141 MCGHYTQVVWAKTVKIGCAVSNC--PNLKGFSAGLFVCNYSPAGNFIGFRPYTRGDSCSMCGQKT 203

  Fly   273 ISEKFPSLC 281
            ...   |||
Mouse   204 CEN---SLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 41/158 (26%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 43/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.