DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Glipr2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_006238202.1 Gene:Glipr2 / 679819 RGDID:1583669 Length:170 Species:Rattus norvegicus


Alignment Length:186 Identity:37/186 - (19%)
Similarity:65/186 - (34%) Gaps:55/186 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQL---LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMA-----ALHAKRC-- 144
            ||.:..:|.   :|..||            .||:...:|.|:...:|.|.|     ||.:.|.  
  Rat    17 EMWQASKQFNNEVLKAHN------------EYRAKHGVPPLKLCKKLNQEAQQYSEALASTRILK 69

  Fly   145 ---QFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHP 206
               :.:..:|         |:|:.:       .|:.:..|.....|:.|        |..|:...
  Rat    70 HSPESSRGQC---------GENLAW-------ASYDQTGKEVADRWYSE--------IKSYNFQQ 110

  Fly   207 QG--KKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQ 260
            .|  ...||||.:|.....::|....    ..|:...|::...:...||.|:..::
  Rat   111 PGFTSGTGHFTAMVWKNTKKIGVGKA----SASDGSSFVVARYFPAGNIVNQGFFE 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 32/167 (19%)
Glipr2XP_006238202.1 SCP_GAPR-1_like 24..155 CDD:240182 32/170 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.