DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_080499.1 Gene:Glipr1l2 / 67537 MGIID:1914787 Length:332 Species:Mus musculus


Alignment Length:181 Identity:38/181 - (20%)
Similarity:66/181 - (36%) Gaps:40/181 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 MHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNT---------PRF 157
            :||..|..:       :....::..:.||..|.:.|....|:|.::    |||         |.|
Mouse    57 LHNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCMYS----RNTHLDKLHESHPVF 110

  Fly   158 KFSGQNIGYFWIG--REFKSHSRRMKSFVINWFREHQD---ANQSFIDRYHPHPQGKKIGHFTLL 217
            ...|:|:   |:|  .:|     .:.:.:.:|..|.:.   .|.:.:       :.:...|:..|
Mouse   111 TEIGENM---WVGPVEDF-----TVTTAIRSWHEERKSYSYLNDTCV-------EDQNCSHYIQL 160

  Fly   218 VSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKC 268
            |.|...:||||..............:..|||..........||:|...|:|
Mouse   161 VWDSSYKVGCAVTSCARAGGFTHAALFICNYAPGGTLTRRPYQAGQFCSRC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 32/160 (20%)
Glipr1l2NP_080499.1 SCP 49..194 CDD:294090 33/162 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..332
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841430
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.