DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Crisp1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001034482.2 Gene:Crisp1 / 654517 RGDID:1590757 Length:254 Species:Rattus norvegicus


Alignment Length:221 Identity:43/221 - (19%)
Similarity:82/221 - (37%) Gaps:45/221 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKC- 151
            :.|.....::.::|.||..|..::.       .|.:|..:.|.:...:.|.:.|:.|    ||. 
  Rat    38 ITESQTEPQEEIVDTHNAFRRNVSP-------PARNMLKMSWSSAAAENARILARYC----DKSD 91

  Fly   152 -----RNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGK-- 209
                 |..|. .|.|:|:       ..:::.....:.:..|:      |:|...:|...|...  
  Rat    92 SDSLERRLPN-TFCGENM-------HMENYPSSWSNVIEIWY------NESKYFKYGEWPSTDDD 142

  Fly   210 -KIGHFTLLVSDRVNRVGC--AGVRFLEPKSNRFQFMLTCNY----DYNNIFNEPIYQSGPAGSK 267
             :..|:|.:|......:||  |..|    :.....::..|:|    :..:..|.| |:.||....
  Rat   143 IETYHYTQMVWASSYLIGCDVASCR----RQKAATYLYVCHYCHEGNSQDTLNMP-YKEGPPCQD 202

  Fly   268 CPQHRISEKFPSLCDWRDANNDLDSE 293
            ||.:.......:.|.:.|..|:.|.:
  Rat   203 CPNNCEDGLCTNPCLYYDEYNNCDKQ 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 31/167 (19%)
Crisp1NP_001034482.2 SCP 46..182 CDD:294090 31/164 (19%)
Crisp 200..254 CDD:285731 6/29 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344743
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.