DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and r3hdml

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001373427.1 Gene:r3hdml / 561976 ZFINID:ZDB-GENE-090313-275 Length:252 Species:Danio rerio


Alignment Length:275 Identity:70/275 - (25%)
Similarity:104/275 - (37%) Gaps:70/275 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSE------ 93
            |:..:|..|..:..|  ..|:|   :||.|:.....:.            |.::...|:      
Zfish     8 LVFAVTLWTAGAEAG--IVAVC---SGTSLLQAEQLSM------------EAEVRNSSDGSTFRV 55

  Fly    94 RRRQL--------LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDK 150
            |||:.        |||.||..||::       :..||:|..:.||..|.:.|...|.:|.:.|. 
Zfish    56 RRRRFISGKDMTALLDYHNRVRSQV-------FPPAANMEYMVWDERLAKSAEFWASQCIWEHG- 112

  Fly   151 CRNTPR--FKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGH 213
                |.  .:..|||:..  |...:||....:||    |:    |...||  .|.....|....|
Zfish   113 ----PHHFLQHIGQNLSI--ISGRYKSIIDLVKS----WY----DERHSF--SYPSRCSGSVCTH 161

  Fly   214 FTLLVSDRVNRVGCAGVRFLEPKSNRFQF--------MLTCNYDY-NNIFNEPIYQSGPAGSKCP 269
            :|.:|....|::|||    ::..|:.|.|        :|.|||.. .|...|..|:.|...|.||
Zfish   162 YTQMVWAASNKIGCA----IKKCSDIFVFGSMWKQATLLVCNYAIKGNWVGEAPYKIGRPCSACP 222

  Fly   270 QHRISEKFPSLCDWR 284
            .........:.||.|
Zfish   223 SSYGGSCNKNQCDSR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 46/170 (27%)
r3hdmlNP_001373427.1 CAP_R3HDML 66..201 CDD:349409 45/162 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585759
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.