DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and PI15

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001311332.1 Gene:PI15 / 51050 HGNCID:8946 Length:258 Species:Homo sapiens


Alignment Length:282 Identity:70/282 - (24%)
Similarity:102/282 - (36%) Gaps:86/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AVLLFVLACEKGLAGAQTLIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPA 81
            :.|||.|.||   |....|:.:..::.|.::.....|||....:...:                 
Human     9 SALLFSLLCE---ASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADI----------------- 53

  Fly    82 CGPEPKLLEMSERRRQL-------LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAAL 139
                ||    :.|:|.:       :||.||..|.|:       :..||:|..:.||..|.:.|..
Human    54 ----PK----ARRKRYISQNDMIAILDYHNQVRGKV-------FPPAANMEYMVWDENLAKSAEA 103

  Fly   140 HAKRCQFAHDKCRNTPRF--KFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRY 202
            .|..|.:.|.     |.:  :|.|||:. ...||     .|.:...|..|:.|.:|  .:|    
Human   104 WAATCIWDHG-----PSYLLRFLGQNLS-VRTGR-----YRSILQLVKPWYDEVKD--YAF---- 151

  Fly   203 HPHPQ-----------GKKIGHFTLLVSDRVNRVGCAGVRFLEPKSN--------RFQFMLTCNY 248
             |:||           |....|:|.:|....||:|||    :....|        |....|.|||
Human   152 -PYPQDCNPRCPMRCFGPMCTHYTQMVWATSNRIGCA----IHTCQNMNVWGSVWRRAVYLVCNY 211

  Fly   249 -DYNNIFNEPIYQSGPAGSKCP 269
             ...|...|..|:.|...|.||
Human   212 APKGNWIGEAPYKVGVPCSSCP 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 48/181 (27%)
PI15NP_001311332.1 CAP_PI15 67..212 CDD:349408 46/173 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151206
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.