DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_002729836.2 Gene:Glipr1l1 / 503139 RGDID:1563000 Length:235 Species:Rattus norvegicus


Alignment Length:188 Identity:48/188 - (25%)
Similarity:80/188 - (42%) Gaps:30/188 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRN-----TPRFKF 159
            |:.||.||.|:..       .|::|..|.||..|.::|....:.|:|:|:.|.:     |..:.:
  Rat    46 LNSHNEARRKVQP-------PASNMNQLSWDKSLAKLAKSWTRECKFSHNPCTSKRHGCTKDYDY 103

  Fly   160 SGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNR 224
            .|:||   ::|:    ...|.:..|.:|:.|.:|.|      :..:...|..||:|.:|..:..:
  Rat   104 IGENI---YLGK----IDARPEDVVFSWYNETKDYN------FDDNTCTKTCGHYTQVVWAKTLK 155

  Fly   225 VGCAGVRFLEPKSNRFQFMLTCNY-DYNNIFNEPIYQSGPAGSKCPQHRISEKFPSLC 281
            :||| :......:.....:..||| ...|......|..|...|.|.:   .|...|||
  Rat   156 IGCA-ISNCPHLTGYSAGLFVCNYVPAGNFQGSKPYIKGEPCSMCGE---KECVNSLC 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 39/154 (25%)
Glipr1l1XP_002729836.2 SCP 40..181 CDD:294090 39/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344785
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.