DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and crisp1.3

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001008204.1 Gene:crisp1.3 / 493566 XenbaseID:XB-GENE-951048 Length:240 Species:Xenopus tropicalis


Alignment Length:196 Identity:48/196 - (24%)
Similarity:83/196 - (42%) Gaps:31/196 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAH---DKCRNTPRFK 158
            |::::.||..|...:.       ||.:|..:.|:.:....||..|..|..:|   || |..|.|.
 Frog    36 QIIINAHNNYRRNASP-------SARNMLKMVWNKDAAINAASWAATCSESHSPSDK-RTIPGFG 92

  Fly   159 FSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVN 223
             .|:|:       ...|:....:..|..|:.|:.|    |.....|...|...||:|.::.....
 Frog    93 -CGENL-------YMASYPASWEEAVKGWYSEYND----FQYGVGPKSPGLVTGHYTQVMWYNSY 145

  Fly   224 RVGCAGVRFLEPKSNRFQFMLTCNY----DYNNIFNEPIYQSGPAGSKCPQHRISEKFPSLCDWR 284
            .|||: |.:. ||| .:::...|.|    :.::..:.| |::||..:.||....:....:.|.::
 Frog   146 MVGCS-VSYC-PKS-PYKYFYVCQYCPAGNLDSTMSTP-YKTGPKCADCPTACDNGLCTNYCPYQ 206

  Fly   285 D 285
            |
 Frog   207 D 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 40/158 (25%)
crisp1.3NP_001008204.1 CAP_CRISP 33..170 CDD:349402 40/156 (26%)
Crisp 187..240 CDD:369954 4/21 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.