DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Ag5r

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001245671.1 Gene:Ag5r / 44631 FlyBaseID:FBgn0015010 Length:256 Species:Drosophila melanogaster


Alignment Length:273 Identity:81/273 - (29%)
Similarity:125/273 - (45%) Gaps:29/273 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VLLFVLACEKGLAGAQTLIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPAC 82
            |::|.|:...|:               ||:..||..:.....|         ..|.|||:::.:|
  Fly     5 VIIFSLSLAFGI---------------ASATDYCKKSCGSTKN---------LGCDNNGAWASSC 45

  Fly    83 GPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFA 147
            ..:..||.:|...:..|:...|..|:.||.|......:|..|..::|:.||..:|:|:.|.||..
  Fly    46 PSDATLLTLSSAEKDALVARTNEYRNHIAGGLNANLSAACRMATIKWNDELAYLASLNVKSCQMK 110

  Fly   148 HDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN-WFREHQDANQSFIDRYHPHPQGKKI 211
            ||.|.||..|.:||||:.  |:|.....:......:.:: |:.|.....|::||.|..:..|..|
  Fly   111 HDGCHNTDAFDWSGQNLA--WMGYYNPLNVTHYLEWGVDMWYDEAVYTKQAYIDAYPSNYNGPAI 173

  Fly   212 GHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQS-GPAGSKCPQHRISE 275
            ||||:||:||...||||...:.....:...|:|.|||...|:....:|.| ..|.|||.. ..:.
  Fly   174 GHFTVLVADRNTEVGCAAATYSVSGQSYKAFLLACNYAATNVLGIKMYSSCSKAASKCTT-GTNP 237

  Fly   276 KFPSLCDWRDANN 288
            |:..||..::..|
  Fly   238 KYKYLCSAKEEYN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 52/153 (34%)
Ag5rNP_001245671.1 SCP_euk 59..211 CDD:240180 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440692
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.