DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG8483

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650264.1 Gene:CG8483 / 41623 FlyBaseID:FBgn0038126 Length:392 Species:Drosophila melanogaster


Alignment Length:241 Identity:63/241 - (26%)
Similarity:98/241 - (40%) Gaps:24/241 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQ 145
            ||..:.....::...|.::|..||..|..:|:|...|...|.:|..:.||.||...|...|..||
  Fly    22 ACNGKIIASGITAEERSIILQEHNRLRQIVATGRYPGQPGAENMREIVWDDELAARAQKWADNCQ 86

  Fly   146 FAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKK 210
            |.||..|...||.. |||:...|......:......|.:.:||.|.|  ..||.|.:.|     |
  Fly    87 FRHDPHRTINRFTM-GQNLAIIWSTAPLDADDGDFPSRIQSWFNEVQ--KYSFGDAWSP-----K 143

  Fly   211 IGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNY-DYNNIFNEPIYQSGPAGSKCPQHRIS 274
            .||::.||....:.|||....:.:  ::::..:..||| ...|:.....|:.|.........:.|
  Fly   144 TGHYSQLVWGETSLVGCGYAEYKD--TSKYNKLYVCNYGPGGNVVGYNPYEVGKPSCSTYGMKPS 206

  Fly   275 EKFPSLCDWRDAN---------NDLDSEE----SDEDGNTLDNNIP 307
            .::..||....::         |.:::.|    |.....|.:||.|
  Fly   207 SRYQGLCAAPGSSPAANSVYGANTIETYEYGYNSSPSSQTANNNPP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 48/153 (31%)
CG8483NP_650264.1 SCP_euk 37..180 CDD:240180 47/152 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455054
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102857at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.