DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scpr-A

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_650062.1 Gene:scpr-A / 41358 FlyBaseID:FBgn0037889 Length:264 Species:Drosophila melanogaster


Alignment Length:262 Identity:81/262 - (30%)
Similarity:134/262 - (51%) Gaps:19/262 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 ASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSK 109
            :|:..|||...|         ...|.||.|.|:||..|..:.:.::: |...:|:|::.|..|:.
  Fly    18 SSAVDYCALPTC---------LDKHVACNNKGNFSENCPKDVREVKI-EPHHKLILNLFNELRNN 72

  Fly   110 IASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYF-WIGREF 173
            :|.|.::|...|..|..:.|..||..:|.|:.|.|:...||||:|.||.::|||...| :.|.|.
  Fly    73 VAGGKIEGLPKAVRMAKMSWCEELSHLALLNVKTCESLPDKCRSTERFAYAGQNNALFQYSGAET 137

  Fly   174 K-SHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKS 237
            : :.:..:|..:.|||.|..:|:...:..:......|.:..||:.|:::...||||.|||.....
  Fly   138 EYTDAEIIKEEIENWFAERSNASPEILASFPEELPNKAVTKFTIAVAEKNTHVGCAAVRFSRDFY 202

  Fly   238 NRFQFMLTCNYDYNNIFNEPIYQSG-PAGSKCP-QHRISEKFPSLCDWRDANNDLDSEESDEDGN 300
            |  .|:||||:..:||..:|:|..| .|.:.|. ::..:..:|:||   .|....|:|:..|:..
  Fly   203 N--HFVLTCNFATSNIVGQPVYTPGEKATTGCKNRYGAAYDYPNLC---YAKEIYDNEKVIENTQ 262

  Fly   301 TL 302
            |:
  Fly   263 TM 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 52/154 (34%)
scpr-ANP_650062.1 SCP_euk 60..212 CDD:240180 52/153 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440629
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.