DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG11977

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649855.3 Gene:CG11977 / 41076 FlyBaseID:FBgn0037650 Length:274 Species:Drosophila melanogaster


Alignment Length:296 Identity:73/296 - (24%)
Similarity:126/296 - (42%) Gaps:52/296 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LWAPAVLLFVLACEKGLAGAQTLIETITTT--------TPASSGGYCAAALCELYNGTHLVHVPH 69
            ||| .|::..|.|..|    .|:..|...|        .|.....||.|.:|.       .:..|
  Fly     4 LWA-IVIVAELKCHTG----HTVFRTRWPTYVQKKHYNIPVKPPDYCNADICP-------ANKKH 56

  Fly    70 TACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARS-KIASGNLDGYRSAAHMPLLRWDTEL 133
            ..||.. .:|..||...:.:.||:.|..::.:::|..|. :...|||.   .|.....::||.||
  Fly    57 ITCGFK-FWSTKCGRNHEGVRMSDYRYDIVRNVNNFRRKLEWGLGNLP---RAVKFKNIKWDDEL 117

  Fly   134 EQMAALHAKRC-QFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQS 197
            ..||...:.:| |.....|.||..:|..|::..:..:....|..:  :.||:..||..|:....|
  Fly   118 SVMAMRVSNQCLQHTFSPCVNTFLYKDVGESSDFVKVQNTSKGFN--VISFLNMWFEYHKMMKPS 180

  Fly   198 FIDRYHPH--PQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQ 260
            :::.: |:  ||.:.| .|..|:.::..::||..|     ||.:.:| |||.:|.....|:.:|.
  Fly   181 YVNNF-PNIAPQDRLI-IFANLIYEKNKKMGCGMV-----KSGQGRF-LTCLFDKKIKPNQKLYT 237

  Fly   261 SGPAGSKCPQHRISEKFPSLCDWRDANNDLDSEESD 296
            :          |:::.|.:    ....|:.:|.:|:
  Fly   238 T----------RLNDPFRT----NRKTNETESIQSN 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 41/156 (26%)
CG11977NP_649855.3 SCP_euk 81..226 CDD:240180 42/157 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.