DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG42564

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_649651.2 Gene:CG42564 / 40788 FlyBaseID:FBgn0260766 Length:500 Species:Drosophila melanogaster


Alignment Length:311 Identity:74/311 - (23%)
Similarity:129/311 - (41%) Gaps:48/311 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 AVLLFVLA-CEKGLAGAQTLIETITTTTPA---------SSGG-----------------YCAAA 54
            |:::|::| |        ..|:|..||||:         |.||                 ||..:
  Fly     3 ALVVFLIASC--------LTIQTAATTTPSPAVTEAGHPSPGGSQGQEEPGNSSSTELPDYCDPS 59

  Fly    55 LCELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYR 119
            ||.       ..:.|.||..:......|..:.:|:.:|.:..:.||...|..|..:|.|..:|..
  Fly    60 LCH-------KELKHVACNASIELHDKCSLDAELIVISPKVERFLLRRFNELRDSVAKGGFNGLS 117

  Fly   120 SAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFV 184
            .|:.|..|:|:.||..:|..:.:.|...||:||||...:.:||.:||..|..:.......::..:
  Fly   118 PASRMGTLKWNPELAYLAEFNVRDCVLRHDECRNTKFTQNAGQTVGYRGIKGKLPELEDILRDII 182

  Fly   185 INWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYD 249
            ..|.||....:...|.:|..........:|..:|.:....||||.|:  :.:....|....|||.
  Fly   183 GVWLREKSRTSMVNIMKYVEQESQSPKYNFLQIVLENAESVGCAIVQ--QSRHGWIQTFFACNYG 245

  Fly   250 YNNIFNEPIYQSGPAGSKCPQHRISEKFPSLCDWRDANNDLDSEESDEDGN 300
            :..:...|:|:.|...::..:...:.|:..||    |.:::..:.:.:.||
  Fly   246 HAPVVGSPVYEPGKKAAESCKTGANPKYAHLC----AESEVYEKVTPKAGN 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 41/152 (27%)
CG42564NP_649651.2 SCP_euk 95..245 CDD:240180 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440636
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102857at33392
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.