DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and glipr1b

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_005159058.1 Gene:glipr1b / 393547 ZFINID:ZDB-GENE-040426-1459 Length:255 Species:Danio rerio


Alignment Length:226 Identity:54/226 - (23%)
Similarity:83/226 - (36%) Gaps:63/226 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAH--MPLLRWDTELEQMAALHAKRCQ--- 145
            |.:.|....||  .:..||..|::: |....|.||...  ..:..||.||.:.|...|:.|:   
Zfish    26 PGITEPEFIRR--CVKAHNTHRARV-SPPAAGARSMVRQVFGMQSWDKELAKGARDRARHCKGSH 87

  Fly   146 ------FAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFRE--HQDANQSFIDRY 202
                  |.|      |.|.:.|:||   |:|..|.:.|  :::.|..|.:|  :...|.:.    
Zfish    88 YPSLGHFGH------PLFGWMGENI---WLGSPFSAFS--VENAVHRWSKEGAYSVKNNNC---- 137

  Fly   203 HPHPQGKKIGHFTLLVSDRVNRVGCA------GVR--FLEPKSNRFQFMLTCNY-DYNNIFNEPI 258
                 .:..||:..|:.....::|||      |:.  ...|:|..|    .||| |...:.....
Zfish   138 -----SRLCGHYAQLMWSTSFKMGCAVNVCSKGIENFSTHPESTIF----VCNYGDTGQVHGVTP 193

  Fly   259 YQ----SGPAGSKCPQHRISEKFPSLC--DW 283
            |.    ||.....|..        ::|  ||
Zfish   194 YMAMGCSGCGSEICRD--------NVCRYDW 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 43/174 (25%)
glipr1bXP_005159058.1 SCP 32..185 CDD:294090 44/179 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.