DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG34049

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:235 Identity:45/235 - (19%)
Similarity:64/235 - (27%) Gaps:112/235 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 HAKRC-QFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVI------------------ 185
            |.||| |.|..||:.:.|.....:.:.        |.....:|.|.|                  
  Fly    96 HGKRCLQCAAPKCKTSSRSSIQSKKLK--------KDKKSLLKEFEIYKIPIIRRKPIKQAVLRE 152

  Fly   186 -NWFREHQDAN------------QSFIDRY--------HPHP-QGKKI----------------- 211
             |.:|...:||            |.:.|..        .|:| .|:.|                 
  Fly   153 TNKYRRLHNANPLKMDEKLCSYAQEWADHLADLNKLETRPNPLYGENIMRVRRSKFSVDQILKLW 217

  Fly   212 ------------------GHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPI 258
                              ||||.||......:| .||     ..:.....:.|||.         
  Fly   218 YQEKYNYDYLKPGFNLYTGHFTQLVWRESEFLG-VGV-----ACDVSSIWIVCNYH--------- 267

  Fly   259 YQSGPAGSKCPQHR---ISEKFPSLCDWRDANNDLDSEES 295
                |.|:.....|   :..||..|      .:|||::|:
  Fly   268 ----PPGNVSEHFRENVLPRKFLLL------KSDLDAKET 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 34/184 (18%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 24/144 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455123
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.