DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Glipr2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_081726.1 Gene:Glipr2 / 384009 MGIID:1917770 Length:154 Species:Mus musculus


Alignment Length:155 Identity:30/155 - (19%)
Similarity:56/155 - (36%) Gaps:40/155 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 YRSAAHMPLLRWDTELEQMA-----ALHAKRC-----QFAHDKCRNTPRFKFSGQNIGYFWIGRE 172
            ||:...:|.|:...:|.:.|     ||.:.|.     :.:..:|         |:|:.:      
Mouse    20 YRAQHGVPPLKLCKKLNREAQQYSEALASTRILKHSPESSRGQC---------GENLAW------ 69

  Fly   173 FKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQG--KKIGHFTLLVSDRVNRVGCAGVRFLEP 235
             .|:.:..|.....|:.|        |..|:....|  ...||||.:|.....::|....    .
Mouse    70 -ASYDQTGKDVADRWYSE--------IKSYNFQQPGFTSGTGHFTAMVWKNTKKIGVGKA----S 121

  Fly   236 KSNRFQFMLTCNYDYNNIFNEPIYQ 260
            .|:...|::...:...||.|:..::
Mouse   122 ASDGSSFVVARYFPAGNIVNQGFFE 146

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 27/142 (19%)
Glipr2NP_081726.1 CAP_GAPR1-like 8..139 CDD:349401 27/146 (18%)
Interaction with CAV1. /evidence=ECO:0000250 91..98 1/6 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.