DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG9822

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_611581.1 Gene:CG9822 / 37440 FlyBaseID:FBgn0034623 Length:263 Species:Drosophila melanogaster


Alignment Length:285 Identity:87/285 - (30%)
Similarity:136/285 - (47%) Gaps:54/285 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LLFVLACEKGLAGAQTLIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPACG 83
            ||.:|    |:|.:|.|             .:|...||.    .:.||:   ||.|:|.|..:|.
  Fly    12 LLIIL----GMASSQPL-------------SWCDPDLCP----DNTVHI---ACNNDGKFHESCS 52

  Fly    84 PEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAH 148
            |:..::::...|: |:::.||..|:.||||:|.||..|..|..:.||.|||.:|.|:.|.|...|
  Fly    53 PDATMVDLKPYRK-LIVNEHNKRRNYIASGSLPGYYPATRMATMVWDEELEYLATLNLKTCYLEH 116

  Fly   149 DKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN-----------WFREHQDANQSFIDRY 202
            |.|.|:.||:..|||:    .|.:      |.:::.:|           ||.||:..:.|:|..:
  Fly   117 DDCHNSYRFRNLGQNL----CGVD------RRRNWDLNVTNLVEQSMGLWFGEHKLIDSSYITDF 171

  Fly   203 HPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFM----LTCNYDYNNIFNEPIYQSGP 263
            ......:|.|||...|.||...||||.:||..|   ::.|:    ..|||........|:|.:|.
  Fly   172 KLTKDLEKYGHFVETVLDRNTHVGCAMMRFTNP---QYPFLYIYNTACNYASVYAIGVPVYNAGK 233

  Fly   264 AGSKCPQHRISEKFPSLCDWRDANN 288
            ..|:| :...:.::|:||..::..|
  Fly   234 PASEC-RTGSNPEYPALCSIKEQYN 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 57/167 (34%)
CG9822NP_611581.1 SCP_euk 64..219 CDD:240180 58/168 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440643
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG26030
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.