DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Glipr1l2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:186 Identity:42/186 - (22%)
Similarity:69/186 - (37%) Gaps:46/186 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNT---------P 155
            :::||..|..:       :....::..:.||..|.:.|....|:|.|.    |||         |
  Rat    57 VNLHNELRGTV-------FPPGVNLRFMTWDVALSRTARAWGKKCVFE----RNTHLDKVHESHP 110

  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKSF-----VINWFREHQD---ANQSFIDRYHPHPQGKKIG 212
            .|...|:|:   |:|.|        |.|     :.:|..|.:.   .|.:.|       :.:...
  Rat   111 VFTDIGENM---WVGPE--------KDFTATNAIRSWHEERKSYNYVNDTCI-------EDEDCS 157

  Fly   213 HFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKC 268
            |:..||.|...:||||.....:..:..:..:..|||..........||:|...|:|
  Rat   158 HYIQLVWDHSYKVGCAVTPCAKVGAITYAALFICNYAPGGTLTRRPYQAGQFCSRC 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 36/165 (22%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 37/168 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344806
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.900

Return to query results.
Submit another query.