DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG10651

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:310 Identity:77/310 - (24%)
Similarity:130/310 - (41%) Gaps:63/310 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 LIETITTTTPASSGGYCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPK----LLEMSERR 95
            |..|:......:|..:|.|.||   .|.|::      |.:||:|...|   ||    :::||...
  Fly     8 LFSTLYIQDTGASDKWCKADLC---RGQHVL------CDDNGNFESTC---PKQAAAMVKMSWDM 60

  Fly    96 RQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFS 160
            ..|::|.||..|:|.| |.:|....||.|..:.||.||.::|....:||:...|:|..||     
  Fly    61 IALIVDKHNEYRNKFA-GGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITP----- 119

  Fly   161 GQNIGYFWIGREFKSH------SRRMKSFVINWFREH-QDANQSFIDRYHPHPQGKKIGHFTLLV 218
              |.|:..:....:.:      ...::..:.:||..: :|..|.....:..:.|.....:|.:| 
  Fly   120 --NYGHAEVSYSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLFFSWTKNQQELSKNYFQVL- 181

  Fly   219 SDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNE----PIYQ--SGPAGSKCPQHRISEKF 277
            .||.||||||.|.::.|.  ....:|.|.|:......|    |:|:  ...|.|:|.:.. ::::
  Fly   182 RDRANRVGCAIVEYVRPA--LVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGS-NKQY 243

  Fly   278 PSLC--------------------DWRDANNDLDSEESDEDGNTLDNNIP 307
            .:||                    |:.|...  ::.|:|.:..|....:|
  Fly   244 KNLCHKDELVKTCNGGSLFVEPENDYNDGQE--ENMENDYEFETTVFTLP 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 44/159 (28%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 44/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440518
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5251
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
66.000

Return to query results.
Submit another query.