DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and glipr2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_021327299.1 Gene:glipr2 / 325699 ZFINID:ZDB-GENE-030131-4424 Length:543 Species:Danio rerio


Alignment Length:180 Identity:43/180 - (23%)
Similarity:63/180 - (35%) Gaps:45/180 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 LDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRC----QFAHDKCRNTPRFKFS 160
            |.:||            .||.....|.|.::..|.:.|...|:..    ..||..       |..
Zfish    11 LQVHN------------AYRKQHGAPPLTFNKNLCRSAQQWAEHLLSTKTLAHSN-------KGY 56

  Fly   161 GQNIGYFWIGREFKSHSRRM--KSFVINWFREHQDANQSFIDRYHPHPQ-GKKIGHFTLLVSDRV 222
            |:|:.|.|     .|.::::  ...|.:|:.|.:|.|.|       .|. ..|.||||.:|....
Zfish    57 GENLYYAW-----SSANKKLTGNEAVDSWYGEIKDYNFS-------RPGFSSKTGHFTQVVWKDT 109

  Fly   223 NRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSG--PAGSKCPQ 270
            ..:|..    |....|.. |::.......||.|...::..  |.|||..|
Zfish   110 KELGVG----LATDGNTI-FVVGQYLPAGNIANAGYFEKNVLPTGSKLDQ 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 35/155 (23%)
glipr2XP_021327299.1 SCP_GAPR-1_like 5..135 CDD:240182 35/159 (22%)
SCP_GAPR-1_like 196..326 CDD:240182
SCP_GAPR-1_like 397..528 CDD:240182
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.