DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and CG31286

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_731103.1 Gene:CG31286 / 318662 FlyBaseID:FBgn0051286 Length:205 Species:Drosophila melanogaster


Alignment Length:182 Identity:38/182 - (20%)
Similarity:67/182 - (36%) Gaps:44/182 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 LLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALH---AKRCQFAHD 149
            |.|:::||     |.|.:.:..:.:....|.:|.|      |  :|.:.|.|:   .....:...
  Fly    33 LREINKRR-----DRHGVPKLTLDNVLSKGCQSYA------W--KLSKSATLNYSDPTNKDYTES 84

  Fly   150 KCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFRE-----HQDANQS-----FIDRYHP 204
            .||...:.....:.:..::.||:|.....:.|.|....:|.     :.|||.:     |:.||  
  Fly    85 ICRFEVKRGALSRCVKNWYNGRKFDILDPKAKDFTAMIWRSSVSLGYGDANINALQGVFVVRY-- 147

  Fly   205 HPQGKKIGHFTLLVSDR-----------VNRVGCAGVRFLEPKSNRFQFMLT 245
            .|.|...|.:|..|..|           ..:..||     ..:.||:..:|:
  Fly   148 TPPGNVKGLYTDNVPPRKRKQKKKKRENKQKEDCA-----SRQDNRYVLLLS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 34/174 (20%)
CG31286NP_731103.1 SCP 27..153 CDD:294090 29/134 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455165
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10334
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.