DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Crispld1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001128435.1 Gene:Crispld1 / 316482 RGDID:1564813 Length:500 Species:Rattus norvegicus


Alignment Length:256 Identity:65/256 - (25%)
Similarity:101/256 - (39%) Gaps:73/256 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTP 155
            :::...|.:||:||..||::       |.:|::|..:.||.|||:.|...|:.|.:.|......|
  Rat    57 ITDNDMQSILDLHNKLRSQV-------YPAASNMEYMTWDVELERSAESWAETCLWEHGPTSLLP 114

  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKSFVIN-WFREHQDANQSF---IDRYHP-HPQGKKIGHFT 215
            ..   |||:|..| ||      .|..:|.:. |:.|.:|.:..:   .|.|.| ...|....|:|
  Rat   115 SI---GQNLGAHW-GR------YRPPTFHVQAWYDEVRDFSYPYEHECDPYCPFRCSGPVCTHYT 169

  Fly   216 LLVSDRVNRVGCAGVRF---------LEPKSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCPQ 270
            .:|....:|:||| :..         :.||:    ..|.|||. ..|.:....|:.|...|.|| 
  Rat   170 QVVWATSSRIGCA-INLCHNMNIWGQIWPKA----VYLVCNYSPKGNWWGHAPYKHGKPCSACP- 228

  Fly   271 HRISEKFPS--------LC----------DWRDANNDLDSEES----------DEDGNTLD 303
                   ||        ||          ...:..|:::.:||          .:|.|..|
  Rat   229 -------PSFGGGCRENLCYKEGSDQYYTPQEEETNEIERQESQVHDTHVRTRSDDSNRND 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 48/166 (29%)
Crispld1NP_001128435.1 SCP_euk 63..207 CDD:240180 48/165 (29%)
LCCL 291..375 CDD:128866
LCCL 394..492 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344638
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.