Sequence 1: | NP_572957.1 | Gene: | CG9400 / 32385 | FlyBaseID: | FBgn0030562 | Length: | 308 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038954171.1 | Gene: | Clec18a / 307851 | RGDID: | 1559899 | Length: | 497 | Species: | Rattus norvegicus |
Alignment Length: | 198 | Identity: | 49/198 - (24%) |
---|---|---|---|
Similarity: | 74/198 - (37%) | Gaps: | 42/198 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 86 PKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHD- 149
Fly 150 ----KCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSF--VIN-WFREHQDANQSFIDRYHPHPQ 207
Fly 208 GKKIGHFTLLVSDRVNRVGCAGVR-FLEPKSNRFQFMLTC------NYDYNNIFNEPIYQSGPAG 265
Fly 266 SKC 268 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG9400 | NP_572957.1 | SCP_euk | 96..249 | CDD:240180 | 40/167 (24%) |
Clec18a | XP_038954171.1 | CAP_euk | 77..211 | CDD:349399 | 39/159 (25%) |
CLECT | 361..485 | CDD:153057 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C166344571 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.850 |