DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Clec18a

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_038954171.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:198 Identity:49/198 - (24%)
Similarity:74/198 - (37%) Gaps:42/198 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHD- 149
            |.:..:|.:...|:|..||..||::       :.|||:|..:.|...|.|:|...|..|..:.. 
  Rat    65 PIVQALSRKESFLILTTHNRLRSQV-------HPSAANMQRMDWSESLAQLAQARAALCGTSATP 122

  Fly   150 ----KCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSF--VIN-WFREHQDANQSFIDRYHPHPQ 207
                ..||||..   |.|:....:|         ..||  |:| ||.|.........:..|    
  Rat   123 NLAATLRNTPDV---GWNVQLLPMG---------SASFVEVVNVWFAEGLQYRHGSAECAH---- 171

  Fly   208 GKKIGHFTLLVSDRVNRVGCAGVR-FLEPKSNRFQFMLTC------NYDYNNIFNEPIYQSGPAG 265
            .....|:|.||....:::||.... |::..:..   ...|      |::.|.....| |:.||..
  Rat   172 NATCAHYTQLVWATSSQLGCGWQPCFVDQVATE---AFVCAYSPGGNWEINGKMIAP-YKKGPWC 232

  Fly   266 SKC 268
            |.|
  Rat   233 SLC 235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 40/167 (24%)
Clec18aXP_038954171.1 CAP_euk 77..211 CDD:349399 39/159 (25%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.