DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Glipr1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001011987.1 Gene:Glipr1 / 299783 RGDID:1305978 Length:251 Species:Rattus norvegicus


Alignment Length:252 Identity:62/252 - (24%)
Similarity:95/252 - (37%) Gaps:81/252 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QTLIETITTTTPASSG-GYCAAALCELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRR 96
            |.|:..:.....::|| .|.|:.|.::               .|..|...|              
  Rat     2 QVLLAVMVWMASSASGFSYTASTLPKI---------------TNEDFIEEC-------------- 37

  Fly    97 QLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHD---KCRNTPRFK 158
               :::||..|||       .|..|.:|..:.||.:|.|:|...|:.|.|.|:   ..|..|.|.
  Rat    38 ---VEVHNHFRSK-------AYPPAGNMLYMSWDPKLAQIAKAWAQSCVFQHNPQLHSRIHPNFT 92

  Fly   159 FSGQNIGYFWIGREFKSHSR-RMKSFVINWFREHQDANQSFIDRYHPHPQG--KKI-GHFTLLVS 219
            ..|:||   |:|    |.|. .:::.::.||.|.|         |:....|  ||: ||:|.:|.
  Rat    93 GLGENI---WLG----SLSLFSVRAAILAWFEESQ---------YYDFSTGKCKKVCGHYTQIVW 141

  Fly   220 DRVNRVGCA------GVRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSGPAGSKCPQ 270
            ....::|||      |..|:            |||.....:....|:.|...|.||:
  Rat   142 ADSYKIGCAVQLCPRGANFI------------CNYGPAGNYPTWPYKQGATCSACPK 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 46/165 (28%)
Glipr1NP_001011987.1 CAP 32..168 CDD:412178 49/187 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344722
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5171
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.