DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Pi16

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001163952.1 Gene:Pi16 / 294312 RGDID:1304760 Length:483 Species:Rattus norvegicus


Alignment Length:193 Identity:56/193 - (29%)
Similarity:87/193 - (45%) Gaps:30/193 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 ACGPEPKLLEMSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQ 145
            |.||...|   :|..:|.::::||..|::::.       .|:.|..:|||.||...|..:|::|.
  Rat    27 ATGPATAL---TEDEKQTMVELHNHYRAQVSP-------PASDMLQMRWDDELAAFAKAYAQKCV 81

  Fly   146 FAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKK 210
            :.|:|.|..     .|:|:  |.|..|    ...:...|.||..||:..|.|..    ....|:.
  Rat    82 WGHNKERGR-----RGENL--FAITDE----GMDVPLAVGNWHEEHEYYNLSTA----TCDPGQM 131

  Fly   211 IGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQ---FMLTCNYD-YNNIFNEPIYQSGPAGSKCP 269
            .||:|.:|..:..|:|| |..|.|......:   .:|.|||: ..|:.....||.|...|:||
  Rat   132 CGHYTQVVWSKTERIGC-GSHFCETLQGVEEANIHLLVCNYEPPGNVKGRKPYQEGTPCSQCP 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 43/155 (28%)
Pi16NP_001163952.1 SCP_HrTT-1 39..172 CDD:240186 43/155 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.