DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and GLIPR1L1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:XP_011536436.2 Gene:GLIPR1L1 / 256710 HGNCID:28392 Length:301 Species:Homo sapiens


Alignment Length:311 Identity:73/311 - (23%)
Similarity:109/311 - (35%) Gaps:88/311 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 CEKGLAGAQTLI------ETITTTTP----ASSGGY--------------CAAALCELYNGTHLV 65
            |...|.|..||:      :|.....|    |.:.|:              |.:......:| |..
Human    16 CSSELCGRGTLLPVLPHSDTDKLIQPRWARACAAGWSQGRAWCGGVGKSGCPSRYWSAQSG-HPP 79

  Fly    66 HVPHTACGNNGSFS-----------------PACGPEPKLLEMSERRRQLLLDMHNLARSKIASG 113
            |.||.:......||                 |:. .:|..::.       .::.||..|.|:.. 
Human    80 HPPHPSMALKNKFSCLWILGLCLVATTSSKIPSI-TDPHFIDN-------CIEAHNEWRGKVNP- 135

  Fly   114 NLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNT-----PRFKFSGQNIGYFWIGREF 173
                  .||.|..:.||..|.:||...|.:|:|.|:.|.:.     ..|::.|:||   |:|   
Human   136 ------PAADMKYMIWDKGLAKMAKAWANQCKFEHNDCLDKSYKCYAAFEYVGENI---WLG--- 188

  Fly   174 KSHSRRMKSF-----VINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFL 233
                 .:|||     :..|:.|.|     |.| :......:..||:|.||......|||| |...
Human   189 -----GIKSFTPRHAITAWYNETQ-----FYD-FDSLSCSRVCGHYTQLVWANSFYVGCA-VAMC 241

  Fly   234 EPKSNRFQFMLTCNY-DYNNIFNEPIYQSGPAGSKCPQHRISEKFPSLCDW 283
            .........:..||| ...|..|.|.|..|.:.|.|.:.....|  :||::
Human   242 PNLGGASTAIFVCNYGPAGNFANMPPYVRGESCSLCSKEEKCVK--NLCNY 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 44/163 (27%)
GLIPR1L1XP_011536436.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151311
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I5261
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.