DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and antr

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster


Alignment Length:280 Identity:66/280 - (23%)
Similarity:118/280 - (42%) Gaps:62/280 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 YCAAALC---ELYNGTHLVHVPHTACGNNGSFSPACGPEPKLLEMSERRRQLLLDMHNLARSKIA 111
            :|...||   |:          |..|....:....||.....|.::...:..:|...|:.|:.:|
  Fly    24 HCKPNLCMNSEI----------HVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVA 78

  Fly   112 SGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKS- 175
            || :..|..||.||.:.||.||:::|....::|......|.||.::.:....        |.:| 
  Fly    79 SG-VGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATT--------EIRSK 134

  Fly   176 --HSRRMKSFVINWFREHQDANQSFID---------RYHPHPQGKKIGHFTLLVSDRVNRVGCAG 229
              .::.:||.:::     :...:.|:|         :..|..:|..:||:..|:.|..:|:|| |
  Fly   135 MGRTKSLKSAILD-----KLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGC-G 193

  Fly   230 VRFLEPKSNRFQFMLTCNYDYNNIFNEPIYQSG--PAGSKC---PQHRISEKFPSLCDWRDANND 289
            :|...........:|.|::...::.|...|:.|  ||| ||   |    |:.:..||        
  Fly   194 LRVKGRDEKESNIILLCHFSRASVNNLVPYEEGQIPAG-KCATGP----SQMYQFLC-------- 245

  Fly   290 LDSEESDEDGNTL--DNNIP 307
              ||:...|.|::  ::|:|
  Fly   246 --SEDEYVDANSMVVESNMP 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 39/164 (24%)
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 39/164 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440510
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.