DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and D2062.1

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001293506.1 Gene:D2062.1 / 24104374 WormBaseID:WBGene00017055 Length:204 Species:Caenorhabditis elegans


Alignment Length:170 Identity:36/170 - (21%)
Similarity:56/170 - (32%) Gaps:83/170 - (48%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PKLLEMSERRRQLLLDMHNLARSK------IASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRC 144
            |||       ::|::..|||.|||      :|...:|       :...||..|:       ||..
 Worm    45 PKL-------KELIVAYHNLYRSKHGAPPLVADPVMD-------VAAKRWADEM-------AKSG 88

  Fly   145 QFAHDKCRNTPRFKFSGQNIGYF-----W------------------IGREFKSHSRRMKSFVIN 186
            ..:|:|    || |: |:|:..|     |                  ||.::.|....:.     
 Worm    89 WISHEK----PR-KY-GENVAMFCQSGCWPLPQTLAQAMVHLFYIEGIGYDYSSFKPELL----- 142

  Fly   187 WFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNRVG 226
                                  |:.||||.:|.....::|
 Worm   143 ----------------------KENGHFTQIVWKSSRKIG 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 33/160 (21%)
D2062.1NP_001293506.1 CAP_GAPR1-like 46..189 CDD:349401 35/169 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.