DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and PI16

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001186088.1 Gene:PI16 / 221476 HGNCID:21245 Length:463 Species:Homo sapiens


Alignment Length:213 Identity:56/213 - (26%)
Similarity:97/213 - (45%) Gaps:37/213 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 MSERRRQLLLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTP 155
            :::..::|::::|||.|::::.       :|:.|..:|||.||...|..:|::|.:.|:|.|.. 
Human    28 LTDEEKRLMVELHNLYRAQVSP-------TASDMLHMRWDEELAAFAKAYARQCVWGHNKERGR- 84

  Fly   156 RFKFSGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSD 220
                .|:|:  |.|..|.......|:    .|..|.:..|.|..    ....|:..||:|.:|..
Human    85 ----RGENL--FAITDEGMDVPLAME----EWHHEREHYNLSAA----TCSPGQMCGHYTQVVWA 135

  Fly   221 RVNRVGCAGVRFLEP----KSNRFQFMLTCNYD-YNNIFNEPIYQSGPAGSKCPQHRISEKFPSL 280
            :..|:|| |..|.|.    :....: :|.|||: ..|:..:..||.|...|:||.....:.  ||
Human   136 KTERIGC-GSHFCEKLQGVEETNIE-LLVCNYEPPGNVKGKRPYQEGTPCSQCPSGYHCKN--SL 196

  Fly   281 CDWRDANNDLDSEESDED 298
            |:      .:.|.|..:|
Human   197 CE------PIGSPEDAQD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 42/156 (27%)
PI16NP_001186088.1 SCP_HrTT-1 33..166 CDD:240186 42/156 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 262..281
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..341
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..408
O-glycosylated at one site 386..395
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3709
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
55.050

Return to query results.
Submit another query.