DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and Crisp2

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:226 Identity:46/226 - (20%)
Similarity:88/226 - (38%) Gaps:47/226 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 GPEPKLLEMSERRRQL---LLDMHNLARSKIASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRC 144
            |.:|....:...:.|:   :::.||..|..:.....|..:       :.|..:....|...|.:|
Mouse    22 GKDPDFTSLLTNQLQVQREIVNKHNELRRSVNPTGSDILK-------MEWSIQATTNAQKWANKC 79

  Fly   145 QFAHD---------KCRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVI-NWFREHQDANQSFI 199
            ...|.         :|         |:|:        :.|....:.|.|| :|:.|::|    |:
Mouse    80 ILEHSSKDDRKINIRC---------GENL--------YMSTDPTLWSTVIQSWYNENED----FV 123

  Fly   200 DRYHPHPQGKKIGHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTCNY--DYNNIFNEPI-YQS 261
            ......| ...:||:|.||.....::|| |:.:. |..:..::...|:|  ..||:..:.. ||.
Mouse   124 YGVGAKP-NSAVGHYTQLVWYSSFKIGC-GIAYC-PNQDNLKYFYVCHYCPMGNNVMKKSTPYQQ 185

  Fly   262 GPAGSKCPQHRISEKFPSLCDWRDANNDLDS 292
            |...:.||.:..:....:.||:.|..::.:|
Mouse   186 GTPCASCPNNCENGLCTNSCDFEDLLSNCES 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 33/167 (20%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 33/165 (20%)
Crisp 189..243 CDD:285731 6/28 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841367
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.