DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-19

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_507654.2 Gene:scl-19 / 191308 WormBaseID:WBGene00013971 Length:207 Species:Caenorhabditis elegans


Alignment Length:202 Identity:52/202 - (25%)
Similarity:80/202 - (39%) Gaps:27/202 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 EMSERRRQLLLDMHNLARSKIASGNLDGYRS----AAHMPLLRWDTELEQMAALHAKRCQFAHDK 150
            ::|...||.:||.||..||::|.|......:    |.:|..|.:..:.|::|..:...|....: 
 Worm    17 QLSPNGRQQVLDFHNKLRSQVALGVFSANGTIKPPARNMERLTYGQQFERLAQDYVADCPDGLE- 80

  Fly   151 CRNTPRFKFSGQNIGYFWIGREFKSHSRRMKSFVI----NWFREHQDANQSFIDRYHPHPQGKKI 211
               .|    .|:|||..:...:.......|..:||    :|..|.| .|......|:    ...|
 Worm    81 ---IP----IGRNIGMNYYTTKVDETYNSMDEYVIDALNDWAEEFQ-VNGWLSTIYN----DTSI 133

  Fly   212 GHFTLLVSDRVNRVGCAGVRFLEPKSNRFQFMLTC-NYDYNNIFNEPIYQSGPAGSKCPQHRISE 275
            ...:.:|......||| ||:..:|    ...::.| .|...|:...|||:.||..:.||..||..
 Worm   134 SAASQMVWAGTKYVGC-GVKRCDP----INVVVVCMYYQQGNLVGRPIYKEGPPCTACPPMRICP 193

  Fly   276 KFPSLCD 282
            .....||
 Worm   194 GQKECCD 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 38/161 (24%)
scl-19NP_507654.2 SCP 21..167 CDD:214553 38/163 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.