DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-17

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_493975.1 Gene:scl-17 / 190174 WormBaseID:WBGene00021780 Length:246 Species:Caenorhabditis elegans


Alignment Length:207 Identity:54/207 - (26%)
Similarity:78/207 - (37%) Gaps:44/207 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 QLLLDMHNLARSKIASGNLDGY--RSAAHMPL-----LRWDTELEQMAALHAKRCQFAHDKCRNT 154
            |..||.||..||.||.|.   |  :...|.|.     ::|:..:...|..||.:|...||    .
 Worm    25 QQTLDAHNEFRSSIAKGT---YVTKGLLHAPATNIMKMKWNVTIATAAQNHANKCPKGHD----G 82

  Fly   155 PRFKFSGQNIGYFWIGREFKSHSRRMKSFVIN---------WFREHQD---ANQSFIDRYHPHPQ 207
            |....||:   ..|.|     |....|.  :|         |..|:..   ......|.:.    
 Worm    83 PLEGVSGE---CMWSG-----HINASKG--VNHLGAVAAKAWSSEYTKKGWETDVMSDEFF---- 133

  Fly   208 GKKIGHFTLLV-SDRVNRVGCAGVRFLEPKSNRFQFMLTCNYDYNNIFNEPI-YQSGPAGSKCPQ 270
            ...:||..::. ..:|| ||| ||:..:.:.:....::.|.|......|..| |:|||..|.||.
 Worm   134 NSGVGHAIIMTWYSQVN-VGC-GVKLCQKEGDYQLAIVVCKYWGEGQGNGKIMYESGPTCSACPP 196

  Fly   271 HRISEKFPSLCD 282
            :...::...|||
 Worm   197 NTTCDQATGLCD 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 41/171 (24%)
scl-17NP_493975.1 CAP_euk 25..174 CDD:349399 41/171 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.070

Return to query results.
Submit another query.