DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-21

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_507793.1 Gene:scl-21 / 189870 WormBaseID:WBGene00012816 Length:198 Species:Caenorhabditis elegans


Alignment Length:181 Identity:36/181 - (19%)
Similarity:69/181 - (38%) Gaps:35/181 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 DMHNLARSK---IASGNLDGYRSAAHMPLLRWDTELEQMAALHAKRCQFAHDKCRNTPRF---KF 159
            |:.:|..|:   :.|.:::....|:.|..:.|::.|...|...||.|..|.:.  ::|..   :.
 Worm    32 DLRSLVASRRFHLDSRDVETLPPASDMLKMTWNSTLAVAAQKLAKTCFIAVES--SSPGIADKRI 94

  Fly   160 SGQNIGYFWIGREFKSHSRRMKSFVINWFREHQDANQSFIDRYHPHPQGKKIGHFTLLVSDRVNR 224
            ...|:  ..:.:....|.:.  |....|..:..::|...|.                |:..:.:.
 Worm    95 VAANV--VTVAKNALGHWKH--SLNKEWNLKSYNSNYIGIQ----------------LIWAKSSS 139

  Fly   225 VGCAGVRFLEPKSNRFQFMLTCNYD-YNNIFNEPIYQSG------PAGSKC 268
            |||...........|..:.:.|::: ...|..||:|:.|      |||:||
 Worm   140 VGCGFSPCEIDSQGRRWYKVVCSFEKKGGITREPVYKKGKACEACPAGTKC 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 26/153 (17%)
scl-21NP_507793.1 CAP_euk 23..163 CDD:349399 26/152 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X35
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.