DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9400 and scl-25

DIOPT Version :9

Sequence 1:NP_572957.1 Gene:CG9400 / 32385 FlyBaseID:FBgn0030562 Length:308 Species:Drosophila melanogaster
Sequence 2:NP_507364.1 Gene:scl-25 / 188600 WormBaseID:WBGene00011841 Length:212 Species:Caenorhabditis elegans


Alignment Length:211 Identity:44/211 - (20%)
Similarity:69/211 - (32%) Gaps:88/211 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SAAHM-----PLLRWDTE-LEQMAALHAKRCQFAHDKCRNTPRFKFSGQNIGYFWIGREFKSHSR 178
            :|||.     |..||:.| ::.:.        |.|:|.||.....        .|   |..|.|:
 Worm    12 AAAHADRHFNPQHRWNAEAIDNIV--------FIHNKLRNAASHG--------LW---ERHSISK 57

  Fly   179 RMKSFVINWFREHQDANQSFI-----DRYHPHPQ---------GKKIGHFTLLVSDRVNRVGCAG 229
            .....:::|       |:|.:     ::|:..|.         |..|..:.:...|.::.||..|
 Worm    58 SSNMQLLSW-------NESLVAEAENEKYYCEPADNKNLPIKLGDNIYQYDVNTYDDIDGVGAMG 115

  Fly   230 --------VRFLEPKS--NRFQFML-------TCNYD-----------YN-------------NI 253
                    ....|.|:  ||.:.||       .|.|:           ||             ||
 Worm   116 SINKDTHDALKSEAKAAKNRLRQMLYSKSKSIGCIYESCDKIDSKGINYNTRLLICKYSPPLENI 180

  Fly   254 FNEPIYQSGPAGSKCP 269
             :|.::..|...|.||
 Worm   181 -DEKLFDKGEPCSNCP 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9400NP_572957.1 SCP_euk 96..249 CDD:240180 34/165 (21%)
scl-25NP_507364.1 CAP_euk 31..174 CDD:349399 30/168 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10334
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.